MTRF1L antibody (70R-2498)

Rabbit polyclonal MTRF1L antibody raised against the N terminal of MTRF1L

Synonyms Polyclonal MTRF1L antibody, Anti-MTRF1L antibody, Mitochondrial Translational Release Factor 1-Like antibody, MTRF1L, MTRFL 1, MTRFL-1, MGC102748 antibody, MTRFL 1 antibody, MTRFL-1 antibody
Specificity MTRF1L antibody was raised against the N terminal of MTRF1L
Cross Reactivity Human
Applications WB
Immunogen MTRF1L antibody was raised using the N terminal of MTRF1L corresponding to a region with amino acids ELFTRGGPLRTFLERQAGSEAHLKVRRPELLAVIKLLNEKERELRETEHL
Assay Information MTRF1L Blocking Peptide, catalog no. 33R-2544, is also available for use as a blocking control in assays to test for specificity of this MTRF1L antibody

Images

Western Blot analysis using MTRF1L antibody (70R-2498)

MTRF1L antibody (70R-2498) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 30 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MTRF1L antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance MTRF1L is a mitochondrial peptide chain release factor that directs the termination of translation in response to the peptide chain termination codons UAA and UAG.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using MTRF1L antibody (70R-2498) | MTRF1L antibody (70R-2498) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors