MUC1 antibody (70R-6603)

Rabbit polyclonal MUC1 antibody raised against the middle region of MUC1

Synonyms Polyclonal MUC1 antibody, Anti-MUC1 antibody, MUC1, MUC 1 antibody, PUM antibody, MUC-1 antibody, MAM6 antibody, MUC 1, Mucin 1 Cell Surface Associated antibody, H23AG antibody, CD227 antibody, MUC-1, EMA antibody, PEMT antibody, PEM antibody
Specificity MUC1 antibody was raised against the middle region of MUC1
Cross Reactivity Human
Applications WB
Immunogen MUC1 antibody was raised using the middle region of MUC1 corresponding to a region with amino acids ASSTPGGEKETSATQRSSVPSSTEKNAFNSSLEDPSTDYYQELQRDISEM
Assay Information MUC1 Blocking Peptide, catalog no. 33R-1532, is also available for use as a blocking control in assays to test for specificity of this MUC1 antibody

Images

Western Blot analysis using MUC1 antibody (70R-6603)

MUC1 antibody (70R-6603) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 14 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MUC1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance MUC1 is a membrane bound, glycosylated phosphoprotein. The protein is anchored to the apical surface of many epithelia by a transmembrane domain, with the degree of glycosylation varying with cell type. It also includes a 20 aa variable number tandem repeat (VNTR) domain, with the number of repeats varying from 20 to 120 in different individuals. The protein serves a protective function by binding to pathogens and also functions in a cell signaling capacity. Overexpression, aberrant intracellular localization, and changes in glycosylation of this protein have been associated with carcinomas.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using MUC1 antibody (70R-6603) | MUC1 antibody (70R-6603) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors