MUC1 antibody (70R-7293)

Rabbit polyclonal MUC1 antibody raised against the N terminal of MUC1

Synonyms Polyclonal MUC1 antibody, Anti-MUC1 antibody, MUC 1, EMA antibody, CD227 antibody, PEMT antibody, H23AG antibody, MUC-1, MUC-1 antibody, MUC 1 antibody, PEM antibody, MAM6 antibody, MUC1, Mucin 1 Cell Surface Associated antibody, PUM antibody
Specificity MUC1 antibody was raised against the N terminal of MUC1
Cross Reactivity Human
Applications WB
Immunogen MUC1 antibody was raised using the N terminal of MUC1 corresponding to a region with amino acids SATQRSSVPSSTEKNALSTGVSFFFLSFHISNLQFNSSLEDPSTDYYQEL
Assay Information MUC1 Blocking Peptide, catalog no. 33R-8320, is also available for use as a blocking control in assays to test for specificity of this MUC1 antibody


Immunohistochemical staining using MUC1 antibody (70R-7293)

MUC1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 27 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MUC1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance MUC1 is a membrane bound, glycosylated phosphoprotein. The protein is anchored to the apical surface of many epithelia by a transmembrane domain, with the degree of glycosylation varying with cell type. It also includes a 20 aa variable number tandem repeat (VNTR) domain, with the number of repeats varying from 20 to 120 in different individuals. The protein serves a protective function by binding to pathogens and also functions in a cell signaling capacity. Overexpression, aberrant intracellular localization, and changes in glycosylation of this protein have been associated with carcinomas.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using MUC1 antibody (70R-7293) | MUC1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X
  • Western Blot analysis using MUC1 antibody (70R-7293) | MUC1 antibody (70R-7293) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors