MUC12 antibody (70R-6626)

Rabbit polyclonal MUC12 antibody raised against the middle region of MUC12

Synonyms Polyclonal MUC12 antibody, Anti-MUC12 antibody, MUC 12 antibody, MUC-12, MUC11 antibody, Mucin 12 Cell Surface Associated antibody, MUC12, MUC 12, MUC-12 antibody
Specificity MUC12 antibody was raised against the middle region of MUC12
Cross Reactivity Human
Applications WB
Immunogen MUC12 antibody was raised using the middle region of MUC12 corresponding to a region with amino acids PSVLVGDSTPSPISSGSMETTALPGSTTKPGLSEKSTTFYSSPRSPDTTH
Assay Information MUC12 Blocking Peptide, catalog no. 33R-7378, is also available for use as a blocking control in assays to test for specificity of this MUC12 antibody

Images

Western blot analysis using MUC12 antibody (70R-6626)

Recommended MUC12 Antibody Titration: 0.2-1 ug/ml

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 81 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MUC12 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance MUC12 is involved in epithelial cell protection, adhesion modulation, and signaling. It may be involved in epithelial cell growth regulation. The protein is stimulated by both cytokine TNF-alpha and TGF-beta in intestinal epithelium.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western blot analysis using MUC12 antibody (70R-6626) | Recommended MUC12 Antibody Titration: 0.2-1 ug/ml

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors