MUC3B antibody (70R-6348)

Rabbit polyclonal MUC3B antibody raised against the N terminal of MUC3B

Synonyms Polyclonal MUC3B antibody, Anti-MUC3B antibody, MUC3B, MUCB 3, MUCB 3 antibody, MUCB-3 antibody, MUC3 antibody, Intestinal Mucin Muc3B Precursor antibody, MUC3A antibody, MUCB-3
Specificity MUC3B antibody was raised against the N terminal of MUC3B
Cross Reactivity Human
Applications WB
Immunogen MUC3B antibody was raised using the N terminal of MUC3B corresponding to a region with amino acids MLCADVVETEVGMEVSVDQQFSPDLNDNTSQAYRDFNKTFWNQMQKIFAD
Assay Information MUC3B Blocking Peptide, catalog no. 33R-6182, is also available for use as a blocking control in assays to test for specificity of this MUC3B antibody

Images

Western Blot analysis using MUC3B antibody (70R-6348)

MUC3B antibody (70R-6348) used at 0.5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 35 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MUC3B antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance MUC3B is major glycoprotein component of a variety of mucus gels. It is thought to provide a protective, lubricating barrier against particles and infectious agents at mucosal surfaces.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using MUC3B antibody (70R-6348) | MUC3B antibody (70R-6348) used at 0.5 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors