Mucolipin 1 antibody (70R-5139)

Rabbit polyclonal Mucolipin 1 antibody raised against the N terminal of MCOLN1

Synonyms Polyclonal Mucolipin 1 antibody, Anti-Mucolipin 1 antibody, Mucolipin 1, Mucolipin -1 antibody, Mucolipin 1, Mucolipin 1 antibody, Mucolipin -1, MCOLN1 antibody
Specificity Mucolipin 1 antibody was raised against the N terminal of MCOLN1
Cross Reactivity Human,Dog
Applications WB
Immunogen Mucolipin 1 antibody was raised using the N terminal of MCOLN1 corresponding to a region with amino acids FRHLFLLGYSDGADDTFAAYTREQLYQAIFHAVDQYLALPDVSLGRYAYV
Assay Information Mucolipin 1 Blocking Peptide, catalog no. 33R-3049, is also available for use as a blocking control in assays to test for specificity of this Mucolipin 1 antibody

Images

Western Blot analysis using Mucolipin 1 antibody (70R-5139)

Mucolipin 1 antibody (70R-5139) used at 0.5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 64 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MCOLN1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance MCOLN1 encodes a protein that may be involved in calcium signaling and membrane trafficking in mucolipidosis IV.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using Mucolipin 1 antibody (70R-5139) | Mucolipin 1 antibody (70R-5139) used at 0.5 ug/ml to detect target protein.

Availability: In stock

Price: $375.00
Size: 50 ug
OR
Shipping
View Our Distributors