MVK antibody (70R-3345)

Rabbit polyclonal MVK antibody raised against the middle region of MVK

Synonyms Polyclonal MVK antibody, Anti-MVK antibody, MVLK antibody, LRBP antibody, Mevalonate Kinase antibody
Specificity MVK antibody was raised against the middle region of MVK
Cross Reactivity Human,Mouse
Applications WB
Immunogen MVK antibody was raised using the middle region of MVK corresponding to a region with amino acids KEDLELINKWAFQGERMIHGNPSGVDNAVSTWGGALRYHQGKISSLKRSP
Assay Information MVK Blocking Peptide, catalog no. 33R-4319, is also available for use as a blocking control in assays to test for specificity of this MVK antibody

Western Blot analysis using MVK antibody (70R-3345)

MVK antibody (70R-3345) used at 1 ug/ml to detect target protein.

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 42 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MVK antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance MVK is the peroxisomal enzyme mevalonate kinase. Mevalonate is a key intermediate, and mevalonate kinase a key early enzyme, in isoprenoid and sterol synthesis. Mevalonate kinase deficiency caused by mutation of this gene results in mevalonic aciduria, a disease characterized psychomotor retardation, failure to thrive, hepatosplenomegaly, anemia and recurrent febrile crises. Defects in this gene also cause hyperimmunoglobulinaemia D and periodic fever syndrome, a disorder characterized by recurrent episodes of fever associated with lymphadenopathy, arthralgia, gastrointestinal dismay and skin rash.

Add a Paper

Sorry, but there are no references currently for this product.

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

  • Western Blot analysis using MVK antibody (70R-3345) | MVK antibody (70R-3345) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors