MYD88 antibody (70R-5823)

Rabbit polyclonal MYD88 antibody

Synonyms Polyclonal MYD88 antibody, Anti-MYD88 antibody, MYD 88, Myeloid Differentiation Primary Response Gene 88 antibody, MYD-88 antibody, MYD-88, MYD88, MYD 88 antibody
Cross Reactivity Human
Applications WB
Immunogen MYD88 antibody was raised using a synthetic peptide corresponding to a region with amino acids TCVWSIASELIEKRCRRMVVVVSDDYLQSKECDFQTKFALSLSPGAHQKR
Assay Information MYD88 Blocking Peptide, catalog no. 33R-9003, is also available for use as a blocking control in assays to test for specificity of this MYD88 antibody

Images

Western Blot analysis using MYD88 antibody (70R-5823)

MYD88 antibody (70R-5823) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 33 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MYD88 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes a cytosolic adapter protein that plays a central role in the innate and adaptive immune response. This protein functions as an essential signal transducer in the interleukin-1 and Toll-like receptor signaling pathways.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using MYD88 antibody (70R-5823) | MYD88 antibody (70R-5823) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors