MYH1 antibody (70R-3929)

Rabbit polyclonal MYH1 antibody raised against the N terminal of MYH1

Synonyms Polyclonal MYH1 antibody, Anti-MYH1 antibody, MYH-1, MGC133384 antibody, MYHSA1 antibody, MyHC-2X/D antibody, MYH 1, MYHa antibody, MYH-1 antibody, MYH1, MYH 1 antibody, Myosin Heavy Chain 1 Skeletal Muscle Adult antibody
Specificity MYH1 antibody was raised against the N terminal of MYH1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen MYH1 antibody was raised using the N terminal of MYH1 corresponding to a region with amino acids KTSVFVVDPKESFVKATVQSREGGKVTAKTEAGATVTVKDDQVFPMNPPK
Assay Information MYH1 Blocking Peptide, catalog no. 33R-4695, is also available for use as a blocking control in assays to test for specificity of this MYH1 antibody

Images

Western Blot analysis using MYH1 antibody (70R-3929)

MYH1 antibody (70R-3929) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 223 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MYH1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Myosin is a major contractile protein which converts chemical energy into mechanical energy through the hydrolysis of ATP.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using MYH1 antibody (70R-3929) | MYH1 antibody (70R-3929) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors