N antibody (70R-4590)

Rabbit polyclonal N antibody

Synonyms Polyclonal N antibody, Anti-N antibody, Alpha Acetyltransferase 38, Natc Auxiliary Subunit antibody, YJR022W antibody, LSM8 antibody
Cross Reactivity Human
Applications WB
Immunogen N antibody was raised using a synthetic peptide corresponding to a region with amino acids MTSALENYINRTVAVITSDGRMIVGTLKGFDQTINLILDESHERVFSSSQ
Assay Information N Blocking Peptide, catalog no. 33R-6561, is also available for use as a blocking control in assays to test for specificity of this N antibody

Images

Western Blot analysis using N antibody (70R-4590)

N antibody (70R-4590) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 10 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LSM8 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes a member of the like-Sm family of proteins. The encoded protein consists of a closed barrel shape, made up of five anti-parallel beta strands and an alpha helix. This protein partners with six paralogs to form a heteroheptameric ring which transiently binds U6 small nuclear RNAs and is involved in the general maturation of RNA in the nucleus.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using N antibody (70R-4590) | N antibody (70R-4590) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors