N6AMT1 antibody (70R-3428)

Rabbit polyclonal N6AMT1 antibody

Synonyms Polyclonal N6AMT1 antibody, Anti-N6AMT1 antibody, N-6 Adenine-Specific Dna Methyltransferase 1 antibody, N6AMT1, NAMT1 6 antibody, NAMT1 6, PRED28 antibody, NAMT1-6 antibody, C21orf127 antibody, N6AMT antibody, MGC19995 antibody, HEMK2 antibody, NAMT1-6, MTQ2 antibody
Cross Reactivity Human
Applications WB
Immunogen N6AMT1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MAGENFATPFHGHVGRGAFSDVYEPAEDTFLLLNALEAAAAELAGVEICL
Assay Information N6AMT1 Blocking Peptide, catalog no. 33R-5659, is also available for use as a blocking control in assays to test for specificity of this N6AMT1 antibody

Images

Western Blot analysis using N6AMT1 antibody (70R-3428)

N6AMT1 antibody (70R-3428) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 20 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of N6AMT1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The protein encoded by this gene belongs to the methyltransferase superfamily. Alternative splicing occurs at this locus and two transcript variants encoding distinct isoforms have been identified.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using N6AMT1 antibody (70R-3428) | N6AMT1 antibody (70R-3428) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors