NARG1 antibody (70R-4598)

Rabbit polyclonal NARG1 antibody raised against the middle region of NARG1

Synonyms Polyclonal NARG1 antibody, Anti-NARG1 antibody, NARG-1 antibody, NARG-1, Nmda Receptor Regulated 1 antibody, Ga19 antibody, TBDN100 antibody, NATH antibody, NARG 1, NARG 1 antibody, NARG1
Specificity NARG1 antibody was raised against the middle region of NARG1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen NARG1 antibody was raised using the middle region of NARG1 corresponding to a region with amino acids PPVFNTLRSLYKDKEKVAIIEELVVGYETSLKSCRLFNPNDDGKEEPPTT
Assay Information NARG1 Blocking Peptide, catalog no. 33R-7288, is also available for use as a blocking control in assays to test for specificity of this NARG1 antibody

Images

Western Blot analysis using NARG1 antibody (70R-4598)

NARG1 antibody (70R-4598) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 101 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of NARG1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The ARD1A-NARG1 complex displays alpha (N-terminal) acetyltransferase activity that may be important for vascular, hematopoietic and neuronal growth and development. NARG1 is required to control retinal neovascularization in adult ocular endothelial cells. In complex with G22P1 and XRCC5 (Ku80), up-regulates transcription from the osteocalcin promoter.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using NARG1 antibody (70R-4598) | NARG1 antibody (70R-4598) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors