NARS Blocking Peptide (33R-10415)

A synthetic peptide for use as a blocking control in assays to test for specificity of NARS antibody, catalog no. 70R-10325

Synonyms NARS control peptide, NARS antibody Blocking Peptide, Anti-NARS Blocking Peptide, asparaginyl-tRNA synthetase Blocking Peptide, ASNRS Blocking Peptide, NARS1 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues TIYVDSQKENERWNVISKSQLKNIKKMWHREQMKSESREKKEAEDSLRRE
Molecular Weight 60 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Aminoacyl-tRNA synthetases are a class of enzymes that charge tRNAs with their cognate amino acids. Asparaginyl-tRNA synthetase is localized to the cytoplasm and belongs to the class II family of tRNA synthetases. The N-terminal domain represents the signature sequence for the eukaryotic asparaginyl-tRNA synthetases.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: $130.00
Size: 100 ug
OR
Shipping
View Our Distributors