NBEAL1 antibody (70R-4615)

Rabbit polyclonal NBEAL1 antibody raised against the N terminal of NBEAL1

Synonyms Polyclonal NBEAL1 antibody, Anti-NBEAL1 antibody, NBEAL-1 antibody, NBEAL 1 antibody, A530083I02Rik antibody, NBEAL-1, NBEAL 1, ALS2CR17 antibody, Neurobeachin-Like 1 antibody, NBEAL1
Specificity NBEAL1 antibody was raised against the N terminal of NBEAL1
Cross Reactivity Human
Applications WB
Immunogen NBEAL1 antibody was raised using the N terminal of NBEAL1 corresponding to a region with amino acids KDNDKNMSTEDTKKNSDEKTDEEKITSFASANVSSDQWSLEDRHSLDSNT
Assay Information NBEAL1 Blocking Peptide, catalog no. 33R-4298, is also available for use as a blocking control in assays to test for specificity of this NBEAL1 antibody


Western Blot analysis using NBEAL1 antibody (70R-4615)

NBEAL1 antibody (70R-4615) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 153 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of NBEAL1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance NBEAL1 belongs to the WD repeat neurobeachin family. It contains 1 BEACH domain and 2 WD repeats. NBEAL1 is highly expressed in brain, kidney, prostate and testis and weakly expressed in ovary, small intestine, colon and peripheral blood leukocytes. It may be correlative to several tumors, such as ovary serous adenocarcinoma and metastasis mammary gland carcinoma breast.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using NBEAL1 antibody (70R-4615) | NBEAL1 antibody (70R-4615) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors