NCAM2 antibody (70R-6446)

Rabbit polyclonal NCAM2 antibody raised against the middle region of NCAM2

Synonyms Polyclonal NCAM2 antibody, Anti-NCAM2 antibody, NCAM-2 antibody, NCAM 2, MGC51008 antibody, NCAM 2 antibody, Neural Cell Adhesion Molecule 2 antibody, NCAM21 antibody, NCAM2, NCAM-2
Specificity NCAM2 antibody was raised against the middle region of NCAM2
Cross Reactivity Human
Applications WB
Immunogen NCAM2 antibody was raised using the middle region of NCAM2 corresponding to a region with amino acids KGQGDYSKIEIFQTLPVREPSPPSIHGQPSSGKSFKLSITKQDDGGAPIL
Assay Information NCAM2 Blocking Peptide, catalog no. 33R-4400, is also available for use as a blocking control in assays to test for specificity of this NCAM2 antibody

Images

Western Blot analysis using NCAM2 antibody (70R-6446)

NCAM2 antibody (70R-6446) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 91 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of NCAM2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The protein encoded by this gene belongs to the immunoglobulin superfamily. It is a type I membrane protein and may function in selective fasciculation and zone-to-zone projection of the primary olfactory axons.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using NCAM2 antibody (70R-6446) | NCAM2 antibody (70R-6446) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors