NCAPD2 antibody (70R-5556)

Rabbit polyclonal NCAPD2 antibody raised against the C terminal of NCAPD2

Synonyms Polyclonal NCAPD2 antibody, Anti-NCAPD2 antibody, CAP-D2 antibody, Non-Smc Condensin I Complex Subunit D2 antibody, hCAP-D2 antibody, NCAPD-2, NCAPD-2 antibody, CNAP1 antibody, NCAPD2, NCAPD 2 antibody, KIAA0159 antibody, NCAPD 2
Specificity NCAPD2 antibody was raised against the C terminal of NCAPD2
Cross Reactivity Human
Applications WB
Immunogen NCAPD2 antibody was raised using the C terminal of NCAPD2 corresponding to a region with amino acids KAIIDEFEQKLRACHTRGLDGIKELEIGQAGSQRAPSAKKPSTGSRYQPL
Assay Information NCAPD2 Blocking Peptide, catalog no. 33R-4246, is also available for use as a blocking control in assays to test for specificity of this NCAPD2 antibody

Images

Western Blot analysis using NCAPD2 antibody (70R-5556)

NCAPD2 antibody (70R-5556) used at 0.5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 157 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of NCAPD2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance NCAPD2 is the regulatory subunit of the condensin complex, a complex required for conversion of interphase chromatin into mitotic-like condense chromosomes. The condensin complex probably introduces positive supercoils into relaxed DNA in the presence of type I topoisomerases and converts nicked DNA into positive knotted forms in the presence of type II topoisomerases. NCAPD2 may target the condensin complex to DNA via its C-terminal domain.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using NCAPD2 antibody (70R-5556) | NCAPD2 antibody (70R-5556) used at 0.5 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors