NCAPH antibody (70R-5519)

Rabbit polyclonal NCAPH antibody raised against the N terminal of NCAPH

Synonyms Polyclonal NCAPH antibody, Anti-NCAPH antibody, HCAP-H antibody, BRRN1 antibody, Non-Smc Condensin I Complex Subunit H antibody, CAP-H antibody
Specificity NCAPH antibody was raised against the N terminal of NCAPH
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen NCAPH antibody was raised using the N terminal of NCAPH corresponding to a region with amino acids MPLPRKAPLNIPGTPVLEDFPQNDDEKERLQRRRSRVFDLQFSTDSPRLL
Assay Information NCAPH Blocking Peptide, catalog no. 33R-6292, is also available for use as a blocking control in assays to test for specificity of this NCAPH antibody


Western Blot analysis using NCAPH antibody (70R-5519)

NCAPH antibody (70R-5519) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 82 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of NCAPH antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance NCAPH is a member of the barr family and a regulatory subunit of the condensin complex. This complex is required for the conversion of interphase chromatin into condensed chromosomes. The protein is associated with mitotic chromosomes, except during the early phase of chromosome condensation. During interphase, the protein has a distinct punctate nucleolar localization.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using NCAPH antibody (70R-5519) | NCAPH antibody (70R-5519) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors