NCAPH2 antibody (70R-2268)

Rabbit polyclonal NCAPH2 antibody raised against the N terminal of NCAPH2

Synonyms Polyclonal NCAPH2 antibody, Anti-NCAPH2 antibody, NCAPH2, hCAP-H2 antibody, Non-Smc Condensin Ii Complex Subunit H2 antibody, NCAPH-2, NCAPH 2 antibody, 384D8_6 antibody, MGC5305 antibody, MGC2455 antibody, CAP-H2 antibody, MGC18000 antibody, MGC4133 antibody, 384D8-2 antibody, MGC8640 antibody, NCAPH 2, MGC15858 antibody, NCAPH-2 antibody
Specificity NCAPH2 antibody was raised against the N terminal of NCAPH2
Cross Reactivity Human
Applications WB
Immunogen NCAPH2 antibody was raised using the N terminal of NCAPH2 corresponding to a region with amino acids SGVPQEAENEFLSLDDFPDSRTNVDLKNDQTPSEVLIIPLLPMALVAPDE
Assay Information NCAPH2 Blocking Peptide, catalog no. 33R-8502, is also available for use as a blocking control in assays to test for specificity of this NCAPH2 antibody


Western Blot analysis using NCAPH2 antibody (70R-2268)

NCAPH2 antibody (70R-2268) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 68 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of NCAPH2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Condensin complexes I and II play essential roles in mitotic chromosome assembly and segregation. Both condensins contain 2 invariant structural maintenance of chromosome (SMC) subunits, SMC2 and SMC4, but they contain different sets of non-SMC subunits. NCAPH2 is 1 of 3 non-SMC subunits that define condensin II.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using NCAPH2 antibody (70R-2268) | NCAPH2 antibody (70R-2268) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors