NCRNA00114 antibody (70R-3296)

Rabbit polyclonal NCRNA00114 antibody raised against the N terminal Of Ncrna00114

Synonyms Polyclonal NCRNA00114 antibody, Anti-NCRNA00114 antibody, NCRNA00-114, Non coding RNA 114 antibody, NCRNA00114, NCRNA00 114, NCRNA00-114 antibody, NCRNA00 114 antibody
Specificity NCRNA00114 antibody was raised against the N terminal Of Ncrna00114
Cross Reactivity Human
Applications WB
Immunogen NCRNA00114 antibody was raised using the N terminal Of Ncrna00114 corresponding to a region with amino acids SFSKMRTGWRGAIPLRWRNRARNREKPHSPRAVSSPATHSLPPSNPCRLT
Assay Information NCRNA00114 Blocking Peptide, catalog no. 33R-8438, is also available for use as a blocking control in assays to test for specificity of this NCRNA00114 antibody

Images

Western Blot analysis using NCRNA00114 antibody (70R-3296)

NCRNA00114 antibody (70R-3296) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 15 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of NCRNA00114 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The specific function of NCRNA00114 is not yet known.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using NCRNA00114 antibody (70R-3296) | NCRNA00114 antibody (70R-3296) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors