ND5 antibody (70R-7027)

Rabbit polyclonal ND5 antibody

Synonyms Polyclonal ND5 antibody, Anti-ND5 antibody, ND 5 antibody, ND-5 antibody, MTND5 antibody, ND-5, Nadh Dehydrogenase Subunit 5 antibody, ND 5, ND5
Cross Reactivity Human
Applications WB
Immunogen ND5 antibody was raised using a synthetic peptide corresponding to a region with amino acids SIVASTFIISLFPTTMFMCLDQEVIISNWHWATTQTTQLSLSFKLDYFSM
Assay Information ND5 Blocking Peptide, catalog no. 33R-8541, is also available for use as a blocking control in assays to test for specificity of this ND5 antibody

Images

Western Blot analysis using ND5 antibody (70R-7027)

ND5 antibody (70R-7027) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 66 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ND5 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ND5 is the core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using ND5 antibody (70R-7027) | ND5 antibody (70R-7027) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors