ND6 antibody (70R-6303)

Rabbit polyclonal ND6 antibody

Synonyms Polyclonal ND6 antibody, Anti-ND6 antibody, ND 6 antibody, ND-6, ND 6, ND6, MTND6 antibody, ND-6 antibody, Nadh Dehydrogenase Subunit 6 antibody
Cross Reactivity Human
Applications WB
Immunogen ND6 antibody was raised using a synthetic peptide corresponding to a region with amino acids DGVVVVVNFNSVGSWMIYEGEGSGLIREDPIGAGALYDYGRWLVVVTGWT
Assay Information ND6 Blocking Peptide, catalog no. 33R-1970, is also available for use as a blocking control in assays to test for specificity of this ND6 antibody

Images

Western Blot analysis using ND6 antibody (70R-6303)

ND6 antibody (70R-6303) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 19 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ND6 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ND6 is a core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using ND6 antibody (70R-6303) | ND6 antibody (70R-6303) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors