NDN antibody (70R-5658)

Rabbit polyclonal NDN antibody

Synonyms Polyclonal NDN antibody, Anti-NDN antibody, Necdin Homolog antibody, HsT16328 antibody
Cross Reactivity Human
Applications WB
Immunogen NDN antibody was raised using a synthetic peptide corresponding to a region with amino acids VALSNRMPMTGLLLMILSLIYVKGRGARESAVWNVLRILGLRPWKKHSTF
Assay Information NDN Blocking Peptide, catalog no. 33R-9426, is also available for use as a blocking control in assays to test for specificity of this NDN antibody


Western Blot analysis using NDN antibody (70R-5658)

NDN antibody (70R-5658) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 36 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of NDN antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This intronless gene is located in the Prader-Willi syndrome deletion region. It is an imprinted gene and is expressed exclusively from the paternal allele.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using NDN antibody (70R-5658) | NDN antibody (70R-5658) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors