NDRG1 antibody (70R-1121)

Rabbit polyclonal NDRG1 antibody raised against the N terminal of NDRG1

Synonyms Polyclonal NDRG1 antibody, Anti-NDRG1 antibody, CMT4D antibody, N-Myc Downstream Regulated Gene 1 antibody, RIT42 antibody, TDD5 antibody, GC4 antibody, NDRG-1, NDRG-1 antibody, HMSNL antibody, NDRG1, NMSL antibody, CAP43 antibody, PROXY1 antibody, DRG1 antibody, TARG1 antibody, NDR1 antibody, NDRG 1 antibody, NDRG 1, RTP antibody
Specificity NDRG1 antibody was raised against the N terminal of NDRG1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen NDRG1 antibody was raised using the N terminal of NDRG1 corresponding to a region with amino acids MSREMQDVDLAEVKPLVEKGETITGLLQEFDVQEQDIETLHGSVHVTLCG
Assay Information NDRG1 Blocking Peptide, catalog no. 33R-6485, is also available for use as a blocking control in assays to test for specificity of this NDRG1 antibody


Western Blot analysis using NDRG1 antibody (70R-1121)

NDRG1 antibody (70R-1121) used at 2.5 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 43 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of NDRG1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance NDRG1 is a member of the N-myc downregulated protein family which belongs to the alpha/beta hydrolase superfamily. NDRG1 is a cytoplasmic protein involved in stress responses, hormone responses, cell growth, and differentiation. Mutation in its gene has been reported to be causative for hereditary motor and sensory neuropathy-Lom.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using NDRG1 antibody (70R-1121) | NDRG1 antibody (70R-1121) used at 2.5 ug/ml to detect target protein.

Availability: In stock

Price: $275.00
Size: 100 ug
View Our Distributors