NDST3 antibody (70R-7320)

Rabbit polyclonal NDST3 antibody

Synonyms Polyclonal NDST3 antibody, Anti-NDST3 antibody, NDST 3 antibody, MGC130029 antibody, N-Deacetylase/N-Sulfotransferase antibody, NDST-3 antibody, NDST 3, NDST3, MGC130028 antibody, NDST-3, Heparan Glucosaminyl 3 antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen NDST3 antibody was raised using a synthetic peptide corresponding to a region with amino acids PGTDWTVFQINHSAYQPVIFAKVKTPENLSPSISKGAFYATIIHDLGLHD
Assay Information NDST3 Blocking Peptide, catalog no. 33R-7135, is also available for use as a blocking control in assays to test for specificity of this NDST3 antibody


Western Blot analysis using NDST3 antibody (70R-7320)

NDST3 antibody (70R-7320) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 101 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of NDST3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance NDST3 is a member of the heparan sulfate/heparin GlcNAc N-deacetylase/ N-sulfotransferase family. NDST3 is a type II transmembrane protein that resides in the Golgi apparatus. This monomeric bifunctional enzyme catalyzes the N-deacetylation and N-sulfation of N-acetylglucosamine residues in heparan sulfate and heparin, which are the initial chemical modifications required for the biosynthesis of the functional oligosaccharide sequences that define the specific ligand binding activities of heparan sulfate and heparin.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using NDST3 antibody (70R-7320) | NDST3 antibody (70R-7320) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors