NDST4 antibody (70R-7140)

Rabbit polyclonal NDST4 antibody

Synonyms Polyclonal NDST4 antibody, Anti-NDST4 antibody, NDST4, NDST-4, N-Deacetylase/N-Sulfotransferase antibody, NDST-4 antibody, NDST 4, NDST 4 antibody, Heparan Glucosaminyl 4 antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen NDST4 antibody was raised using a synthetic peptide corresponding to a region with amino acids EDWTIFQYNHSTYQPVLLTELQTEKSLSSLSSKTLFATVIQDLGLHDGIQ
Assay Information NDST4 Blocking Peptide, catalog no. 33R-2334, is also available for use as a blocking control in assays to test for specificity of this NDST4 antibody

Images

Western Blot analysis using NDST4 antibody (70R-7140)

NDST4 antibody (70R-7140) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 101 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of NDST4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance NDST4 is an essential bifunctional enzyme that catalyzes both the N-deacetylation and the N-sulfation of glucosamine (GlcNAc) of the glycosaminoglycan in heparan sulfate. It modifies the GlcNAc-GlcA dissacharide repeating sugar backbone to make N-sulfated heparosan, a prerequisite substrate for later modifications in heparin biosynthesis. NDST4 has low deacetylase activity but high sulfotransferase activity.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using NDST4 antibody (70R-7140) | NDST4 antibody (70R-7140) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors