NDUFA9 antibody (70R-2508)

Rabbit polyclonal NDUFA9 antibody

Synonyms Polyclonal NDUFA9 antibody, Anti-NDUFA9 antibody, Nadh Dehydrogenase antibody, NDUFA 9, Ubiquinone 1 Alpha Subcomplex 9 39Kda antibody, NDUFA-9, MGC111043 antibody, NDUFS2L antibody, NDUFA-9 antibody, NDUFA9, NDUFA 9 antibody
Cross Reactivity Human
Applications WB
Immunogen NDUFA9 antibody was raised using a synthetic peptide corresponding to a region with amino acids QLHHALMPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIIPY
Assay Information NDUFA9 Blocking Peptide, catalog no. 33R-7627, is also available for use as a blocking control in assays to test for specificity of this NDUFA9 antibody


Western Blot analysis using NDUFA9 antibody (70R-2508)

NDUFA9 antibody (70R-2508) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 42 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of NDUFA9 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The encoded protein is a subunit of the hydrophobic protein fraction of the NADH:ubiquinone oxidoreductase (complex I), the first enzyme complex in the electron transport chain located in the inner mitochondrial membrane.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using NDUFA9 antibody (70R-2508) | NDUFA9 antibody (70R-2508) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors