NDUFS1 antibody (70R-3459)

Rabbit polyclonal NDUFS1 antibody raised against the middle region of NDUFS1

Synonyms Polyclonal NDUFS1 antibody, Anti-NDUFS1 antibody, MGC26839 antibody, CI-75Kd antibody, NDUFS 1 antibody, NDUFS 1, PRO1304 antibody, NDUFS-1, NDUFS-1 antibody, Nadh Dehydrogenase antibody, Ubiquinone Fe-S Protein 1 75Kda antibody, NDUFS1
Specificity NDUFS1 antibody was raised against the middle region of NDUFS1
Cross Reactivity Human
Applications WB
Immunogen NDUFS1 antibody was raised using the middle region of NDUFS1 corresponding to a region with amino acids TPPGLAREDWKIIRALSEIAGMTLPYDTLDQVRNRLEEVSPNLVRYDDIE
Assay Information NDUFS1 Blocking Peptide, catalog no. 33R-9227, is also available for use as a blocking control in assays to test for specificity of this NDUFS1 antibody


Western Blot analysis using NDUFS1 antibody (70R-3459)

NDUFS1 antibody (70R-3459) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 77 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of NDUFS1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The protein encoded by this gene belongs to the complex I 75 kDa subunit family. Mammalian complex I is composed of 45 different subunits. It locates at the mitochondrial inner membrane. This protein has NADH dehydrogenase activity and oxidoreductase activity. It transfers electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. This protein is the largest subunit of complex I and it is a component of the iron-sulfur (IP) fragment of the enzyme. It may form part of the active site crevice where NADH is oxidized. Mutations in this gene are associated with complex I deficiency.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using NDUFS1 antibody (70R-3459) | NDUFS1 antibody (70R-3459) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors