NECAB3 antibody (70R-3494)

Rabbit polyclonal NECAB3 antibody raised against the N terminal of NECAB3

Synonyms Polyclonal NECAB3 antibody, Anti-NECAB3 antibody, NECAB 3, NECAB 3 antibody, N-Terminal Ef-Hand Calcium Binding Protein 3 antibody, NIP1 antibody, dJ63M2.4 antibody, SYTIP2 antibody, APBA2BP antibody, XB51 antibody, NECAB3, NECAB-3 antibody, EFCBP3 antibody, NECAB-3, dJ63M2.5 antibody, STIP3 antibody
Specificity NECAB3 antibody was raised against the N terminal of NECAB3
Cross Reactivity Human
Applications WB
Immunogen NECAB3 antibody was raised using the N terminal of NECAB3 corresponding to a region with amino acids MACAGLLTVCLLRPPAPQPQPQTPRHPQLAPDPGPAGHTLFQDVFRRADK
Assay Information NECAB3 Blocking Peptide, catalog no. 33R-5616, is also available for use as a blocking control in assays to test for specificity of this NECAB3 antibody


Western Blot analysis using NECAB3 antibody (70R-3494)

NECAB3 antibody (70R-3494) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 44 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of NECAB3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The protein encoded by this gene interacts with the amino-terminal domain of the neuron-specific X11-like protein (X11L), inhibits the association of X11L with amyloid precursor protein through a non-competitive mechanism, and abolishes the suppression of beta-amyloid production by X11L. This protein, together with X11L, may play an important role in the regulatory system of amyloid precursor protein metabolism and beta-amyloid generation. The protein is phosphorylated by NIMA-related expressed kinase 2, and localizes to the Golgi apparatus. Multiple transcript variants encoding different isoforms have been found for this gene.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using NECAB3 antibody (70R-3494) | NECAB3 antibody (70R-3494) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors