NECAB3 antibody (70R-3495)

Rabbit polyclonal NECAB3 antibody raised against the middle region of NECAB3

Synonyms Polyclonal NECAB3 antibody, Anti-NECAB3 antibody, EFCBP3 antibody, XB51 antibody, SYTIP2 antibody, STIP3 antibody, NECAB 3 antibody, APBA2BP antibody, dJ63M2.5 antibody, N-Terminal Ef-Hand Calcium Binding Protein 3 antibody, dJ63M2.4 antibody, NECAB-3 antibody, NECAB3, NECAB-3, NECAB 3, NIP1 antibody
Specificity NECAB3 antibody was raised against the middle region of NECAB3
Cross Reactivity Human
Applications WB
Immunogen NECAB3 antibody was raised using the middle region of NECAB3 corresponding to a region with amino acids ESVEAQSRLCGSRRAGRRALRSVSRSSTWSPGSSDTGRSSEAEMQWRLQV
Assay Information NECAB3 Blocking Peptide, catalog no. 33R-2749, is also available for use as a blocking control in assays to test for specificity of this NECAB3 antibody

Western Blot analysis using NECAB3 antibody (70R-3495)

NECAB3 antibody (70R-3495) used at 1 ug/ml to detect target protein.

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 44 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of NECAB3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The protein encoded by this gene interacts with the amino-terminal domain of the neuron-specific X11-like protein (X11L), inhibits the association of X11L with amyloid precursor protein through a non-competitive mechanism, and abolishes the suppression of beta-amyloid production by X11L. This protein, together with X11L, may play an important role in the regulatory system of amyloid precursor protein metabolism and beta-amyloid generation. The protein is phosphorylated by NIMA-related expressed kinase 2, and localizes to the Golgi apparatus. Multiple transcript variants encoding different isoforms have been found for this gene.

Add a Paper

Sorry, but there are no references currently for this product.

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

  • Western Blot analysis using NECAB3 antibody (70R-3495) | NECAB3 antibody (70R-3495) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors