NECAP2 antibody (70R-3814)

Rabbit polyclonal NECAP2 antibody raised against the N terminal of NECAP2

Synonyms Polyclonal NECAP2 antibody, Anti-NECAP2 antibody, NECAP2, Necap Endocytosis Associated 2 antibody, RP4-798A10.1 antibody, NECAP-2, NECAP 2, NECAP 2 antibody, NECAP-2 antibody, FLJ10420 antibody
Specificity NECAP2 antibody was raised against the N terminal of NECAP2
Cross Reactivity Human, Mouse
Applications WB
Immunogen NECAP2 antibody was raised using the N terminal of NECAP2 corresponding to a region with amino acids WQLDQPSWSGRLRITAKGQMAYIKLEDRTSGELFAQAPVDQFPGTAVESV
Assay Information NECAP2 Blocking Peptide, catalog no. 33R-9994, is also available for use as a blocking control in assays to test for specificity of this NECAP2 antibody

Images

Western Blot analysis using NECAP2 antibody (70R-3814)

NECAP2 antibody (70R-3814) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 28 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of NECAP2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene likely encodes a member of the adaptin-ear-binding coat-associated protein family. Studies of a similar protein in rat suggest a role in clathrin-mediated endocytosis. Alternatively spliced transcript variants have been described.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using NECAP2 antibody (70R-3814) | NECAP2 antibody (70R-3814) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors