NEDD9 antibody (70R-6076)

Rabbit polyclonal NEDD9 antibody raised against the middle region of NEDD9

Synonyms Polyclonal NEDD9 antibody, Anti-NEDD9 antibody, dJ761I2.1 antibody, CASL antibody, dJ49G10.2 antibody, NEDD 9 antibody, NEDD-9, Neural Precursor Cell Expressed Developmentally Down-Regulated 9 antibody, CAS-L antibody, NEDD-9 antibody, HEF1 antibody, NEDD9, NEDD 9
Specificity NEDD9 antibody was raised against the middle region of NEDD9
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen NEDD9 antibody was raised using the middle region of NEDD9 corresponding to a region with amino acids DLVDGINRLSFSSTGSTRSNMSTSSTSSKESSLSASPAQDKRLFLDPDTA
Assay Information NEDD9 Blocking Peptide, catalog no. 33R-2070, is also available for use as a blocking control in assays to test for specificity of this NEDD9 antibody

Images

Western Blot analysis using NEDD9 antibody (70R-6076)

NEDD9 antibody (70R-6076) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 93 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of NEDD9 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Variation in NEDD9 is associated wih susceptibility to late-onset Alzheimer and Parkinson diseases. Changes in expression of the scaffold protein HEF1/CAS-L/NEDD9 were found to be a potent prometastatic stimulus in melanoma and other cancers.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using NEDD9 antibody (70R-6076) | NEDD9 antibody (70R-6076) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors