NEK3 antibody (70R-5504)

Rabbit polyclonal NEK3 antibody

Synonyms Polyclonal NEK3 antibody, Anti-NEK3 antibody, NEK 3 antibody, NEK3, MGC29949 antibody, NEK-3, NEK 3, NEK-3 antibody, Nima antibody, Never In Mitosis Gene A-Related Kinase 3 antibody, HSPK36 antibody
Cross Reactivity Human
Applications WB
Immunogen NEK3 antibody was raised using a synthetic peptide corresponding to a region with amino acids FTQMCLGVNHIHKKRVLHRDIKSKNIFLTQNGKVKLGDFGSARLLSNPMA
Assay Information NEK3 Blocking Peptide, catalog no. 33R-3099, is also available for use as a blocking control in assays to test for specificity of this NEK3 antibody


Western Blot analysis using NEK3 antibody (70R-5504)

NEK3 antibody (70R-5504) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 58 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of NEK3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance NEK3 is a member of the NimA (never in mitosis A) family of serine/threonine protein kinases. It differs from other NimA family members in that it is not cell cycle regulated and is found primarily in the cytoplasm. The kinase is activated by prolactin stimulation, leading to phosphorylation of VAV2 guanine nucleotide exchange factor, paxillin, and activation of the RAC1 GTPase.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using NEK3 antibody (70R-5504) | NEK3 antibody (70R-5504) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors