NEK7 antibody (70R-2229)

Rabbit polyclonal NEK7 antibody

Synonyms Polyclonal NEK7 antibody, Anti-NEK7 antibody, Nima antibody, Never In Mitosis Gene A-Related Kinase 7 antibody, NEK-7 antibody, NEK-7, NEK 7 antibody, NEK7, NEK 7
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen NEK7 antibody was raised using a synthetic peptide corresponding to a region with amino acids KARADCIKEIDLLKQLNHPNVIKYYASFIEDNELNIVLELADAGDLSRMI
Assay Information NEK7 Blocking Peptide, catalog no. 33R-4257, is also available for use as a blocking control in assays to test for specificity of this NEK7 antibody


Western Blot analysis using NEK7 antibody (70R-2229)

NEK7 antibody (70R-2229) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 34 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of NEK7 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance NIMA-related kinases share high amino acid sequence identity with the gene product of the Aspergillus nidulans 'never in mitosis A' gene, which controls initiation of mitosis.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using NEK7 antibody (70R-2229) | NEK7 antibody (70R-2229) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors