Nephronectin antibody (70R-2211)

Rabbit polyclonal Nephronectin antibody raised against the middle region of NPNT

Synonyms Polyclonal Nephronectin antibody, Anti-Nephronectin antibody, POEM antibody, EGFL6L antibody, NPNT antibody
Specificity Nephronectin antibody was raised against the middle region of NPNT
Cross Reactivity Human,Mouse,Rat,Dog
Applications WB
Immunogen Nephronectin antibody was raised using the middle region of NPNT corresponding to a region with amino acids TTGLTTIAPAASTPPGGITVDNRVQTDPQKPRGDVFIPRQPSNDLFEIFE
Assay Information Nephronectin Blocking Peptide, catalog no. 33R-9316, is also available for use as a blocking control in assays to test for specificity of this Nephronectin antibody

Images

Western Blot analysis using Nephronectin antibody (70R-2211)

Nephronectin antibody (70R-2211) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 62 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of NPNT antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance NPNT is a functional ligand of integrin alpha-8/beta-1 in kidney development. It regulates with integrin alpha-8/beta-1 the expression of GDNF which is essential for kidney development. It may also play a role in the development and function of various tissues, regulating cell adhesion, spreading and survival through the binding of several integrins.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using Nephronectin antibody (70R-2211) | Nephronectin antibody (70R-2211) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors