Netrin 4 antibody (70R-7141)

Rabbit polyclonal Netrin 4 antibody raised against the N terminal of NTN4

Synonyms Polyclonal Netrin 4 antibody, Anti-Netrin 4 antibody, Netrin 4, Netrin -4, Netrin -4 antibody, Netrin 4, FLJ23180 antibody, NTN4 antibody, Netrin 4 antibody, PRO3091 antibody
Specificity Netrin 4 antibody was raised against the N terminal of NTN4
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen Netrin 4 antibody was raised using the N terminal of NTN4 corresponding to a region with amino acids EDVHREKIQLDLEAEFYFTHLIVMFKSPRPAAMVLDRSQDFGKTWKPYKY
Assay Information Netrin 4 Blocking Peptide, catalog no. 33R-2330, is also available for use as a blocking control in assays to test for specificity of this Netrin 4 antibody

Images

Immunofluorescent staining using Netrin 4 antibody (70R-7141)

Netrin 4 antibody used at a concentration of 10 ug/ml to detect neurons and epithelial cells in rodent brain (red). Nuclei staining with DAPI.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 70 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of NTN4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance NTN4 contains 3 laminin EGF-like domains, 1 laminin N-terminal domain and 1 NTR domain. NTN4 may play an important role in neural, kidney and vascular development. It promotes neurite elongation from olfactory bulb explants.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Immunofluorescent staining using Netrin 4 antibody (70R-7141) | Netrin 4 antibody used at a concentration of 10 ug/ml to detect neurons and epithelial cells in rodent brain (red). Nuclei staining with DAPI.
  • Western Blot analysis using Netrin 4 antibody (70R-7141) | Netrin 4 antibody (70R-7141) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors