NEU4 antibody (70R-4135)

Rabbit polyclonal NEU4 antibody raised against the N terminal of NEU4

Synonyms Polyclonal NEU4 antibody, Anti-NEU4 antibody, Neu-4, Neu-4 antibody, Neu4, Sialidase 4 antibody, Neu 4 antibody, MGC102757 antibody, MGC18222 antibody, Neu 4
Specificity NEU4 antibody was raised against the N terminal of NEU4
Cross Reactivity Human,Mouse
Applications WB
Immunogen NEU4 antibody was raised using the N terminal of NEU4 corresponding to a region with amino acids TGTVFLFFIAVLGHTPEAVQIATGRNAARLCCVASRDAGLSWGSARDLTE
Assay Information NEU4 Blocking Peptide, catalog no. 33R-9097, is also available for use as a blocking control in assays to test for specificity of this NEU4 antibody


Western Blot analysis using NEU4 antibody (70R-4135)

NEU4 antibody (70R-4135) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 53 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of NEU4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance NEU4 belongs to a family of glycohydrolytic enzymes which remove sialic acid residues from glycoproteins and glycolipids.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using NEU4 antibody (70R-4135) | NEU4 antibody (70R-4135) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors