Neurexophilin 4 antibody (70R-4049)

Rabbit polyclonal Neurexophilin 4 antibody raised against the N terminal of NXPH4

Synonyms Polyclonal Neurexophilin 4 antibody, Anti-Neurexophilin 4 antibody, Neurexophilin 4, Neurexophilin -4, Neurexophilin -4 antibody, NXPH4 antibody, NPH4 antibody, Neurexophilin 4 antibody, Neurexophilin 4
Specificity Neurexophilin 4 antibody was raised against the N terminal of NXPH4
Cross Reactivity Human
Applications WB
Immunogen Neurexophilin 4 antibody was raised using the N terminal of NXPH4 corresponding to a region with amino acids MRLLPEWFLLLFGPWLLRKAVSAQIPESGRPQYLGLRPAAAGAGAPGQQL
Assay Information Neurexophilin 4 Blocking Peptide, catalog no. 33R-6369, is also available for use as a blocking control in assays to test for specificity of this Neurexophilin 4 antibody


Western Blot analysis using Neurexophilin 4 antibody (70R-4049)

Neurexophilin 4 antibody (70R-4049) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 34 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of NXPH4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance NXPH4 may be signaling molecules that resemble neuropeptides and that act by binding to alpha-neurexins and possibly other receptors.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using Neurexophilin 4 antibody (70R-4049) | Neurexophilin 4 antibody (70R-4049) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors