NEURL2 antibody (70R-4136)

Rabbit polyclonal NEURL2 antibody

Synonyms Polyclonal NEURL2 antibody, Anti-NEURL2 antibody, Ozz-E3 antibody, MGC125935 antibody, NEURL 2 antibody, NEURL2, NEURL-2 antibody, Neuralized Homolog 2 antibody, C20orf163 antibody, MGC125934 antibody, NEURL 2, NEURL-2
Cross Reactivity Human
Applications WB
Immunogen NEURL2 antibody was raised using a synthetic peptide corresponding to a region with amino acids VEPYLRIEQFRIPRDRLVGRSRPGLYSHLLDQLYELNVLPPTARRSRLGV
Assay Information NEURL2 Blocking Peptide, catalog no. 33R-9509, is also available for use as a blocking control in assays to test for specificity of this NEURL2 antibody

Images

Western Blot analysis using NEURL2 antibody (70R-4136)

NEURL2 antibody (70R-4136) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 32 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of NEURL2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance NEURL2 contains 1 NHR (neuralized homology repeat) domain and 1 SOCS box domain. NEURL2 plays an important role in the process of myofiber differentiation and maturation.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using NEURL2 antibody (70R-4136) | NEURL2 antibody (70R-4136) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors