Neuropilin antibody (70R-7424)

Rabbit polyclonal Neuropilin antibody raised against the N terminal of NETO2

Synonyms Polyclonal Neuropilin antibody, Anti-Neuropilin antibody, Nrp And Tolloid antibody, FLJ14724 antibody, NETO2 antibody, NEOT2 antibody, FLJ90456 antibody, FLJ10430 antibody
Specificity Neuropilin antibody was raised against the N terminal of NETO2
Cross Reactivity Human,Mouse
Applications WB
Immunogen Neuropilin antibody was raised using the N terminal of NETO2 corresponding to a region with amino acids ELSGADGIVRSSQVEQEEKTKPGQAVDCIWTIKATPKAKIYLRFLDYQME
Assay Information Neuropilin Blocking Peptide, catalog no. 33R-2574, is also available for use as a blocking control in assays to test for specificity of this Neuropilin antibody

Images

Western Blot analysis using Neuropilin antibody (70R-7424)

Neuropilin antibody (70R-7424) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 57 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of NETO2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance NETO2 is a predicted transmembrane protein containing two extracellular CUB domains followed by a low-density lipoprotein class A (LDLa) domain. It also has an intracellular FXNPXY-like motif, which has been shown in other proteins to be essential for the internalization of clathrin coated pits during endocytosis.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using Neuropilin antibody (70R-7424) | Neuropilin antibody (70R-7424) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors