Neuroplastin antibody (70R-1874)

Rabbit polyclonal Neuroplastin antibody raised against the middle region of NPTN

Synonyms Polyclonal Neuroplastin antibody, Anti-Neuroplastin antibody, GP65 antibody, np65 antibody, DKFZp686L2477 antibody, MGC102805 antibody, np55 antibody, GP55 antibody, NPTN antibody, SDR1 antibody, SDFR1 antibody
Specificity Neuroplastin antibody was raised against the middle region of NPTN
Cross Reactivity Human,Mouse,Rat,Dog
Applications IHC, WB
Immunogen Neuroplastin antibody was raised using the middle region of NPTN corresponding to a region with amino acids MEYRINKPRAEDSGEYHCVYHFVSAPKANATIEVKAAPDITGHKRSENKN
Assay Information Neuroplastin Blocking Peptide, catalog no. 33R-5985, is also available for use as a blocking control in assays to test for specificity of this Neuroplastin antibody

Images

Immunohistochemical staining using Neuroplastin antibody (70R-1874)

Neuroplastin antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Skeletal muscle cells (arrows) in Human Muscle. Magnification is at 400X

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 42 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of NPTN antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 5 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Neuroplastin is a type I transmembrane protein belonging to the Ig superfamily. The protein is believed to be involved in cell-cell interactions or cell-substrate interactions. The alpha and beta transcripts show differential localization within the brain.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Immunohistochemical staining using Neuroplastin antibody (70R-1874) | Neuroplastin antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Skeletal muscle cells (arrows) in Human Muscle. Magnification is at 400X
  • Western Blot analysis using Neuroplastin antibody (70R-1874) | Neuroplastin antibody (70R-1874) used at 5 ug/ml to detect target protein.

Availability: In stock

Price: $275.00
Size: 100 ug
OR
Shipping
View Our Distributors