Neuroplastin antibody (70R-7282)

Rabbit polyclonal Neuroplastin antibody raised against the middle region of NPTN

Synonyms Polyclonal Neuroplastin antibody, Anti-Neuroplastin antibody, SDR1 antibody, np55 antibody, MGC102805 antibody, np65 antibody, GP55 antibody, NPTN antibody, SDFR1 antibody, DKFZp686L2477 antibody, GP65 antibody
Specificity Neuroplastin antibody was raised against the middle region of NPTN
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen Neuroplastin antibody was raised using the middle region of NPTN corresponding to a region with amino acids SAPKANATIEVKAAPDITGHKRSENKNEGQDATMYCKSVGYPHPDWIWRK
Assay Information Neuroplastin Blocking Peptide, catalog no. 33R-8310, is also available for use as a blocking control in assays to test for specificity of this Neuroplastin antibody

Images

Western Blot analysis using Neuroplastin antibody (70R-7282)

Neuroplastin antibody (70R-7282) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 29 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of NPTN antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Neuroplastin is a type I transmembrane protein belonging to the Ig superfamily. The protein is believed to be involved in cell-cell interactions or cell-substrate interactions. The alpha and beta transcripts show differential localization within the brain.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using Neuroplastin antibody (70R-7282) | Neuroplastin antibody (70R-7282) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors