NHEDC2 antibody (70R-6490)

Rabbit polyclonal NHEDC2 antibody raised against the C terminal of NHEDC2

Synonyms Polyclonal NHEDC2 antibody, Anti-NHEDC2 antibody, Na+/H+ Exchanger Domain Containing 2 antibody, NHEDC2, NHEDC-2, NHEDC-2 antibody, NHEDC 2, FLJ23984 antibody, NHEDC 2 antibody
Specificity NHEDC2 antibody was raised against the C terminal of NHEDC2
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen NHEDC2 antibody was raised using the C terminal of NHEDC2 corresponding to a region with amino acids IFISFAWLPKATVQAAIGSVALDTARSHGEKQLEDYGMDVLTVAFLSILI
Assay Information NHEDC2 Blocking Peptide, catalog no. 33R-3957, is also available for use as a blocking control in assays to test for specificity of this NHEDC2 antibody

Images

Western Blot analysis using NHEDC2 antibody (70R-6490)

NHEDC2 antibody (70R-6490) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 57 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of NHEDC2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Sodium hydrogen antiporters, such as NHEDC2, convert the proton motive force established by the respiratory chain or the F1F0 mitochondrial ATPase into sodium gradients that drive other energy-requiring processes, transduce environmental signals into cell responses, or function in drug efflux.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using NHEDC2 antibody (70R-6490) | NHEDC2 antibody (70R-6490) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors