NHLRC2 antibody (70R-3406)

Rabbit polyclonal NHLRC2 antibody raised against the N terminal of NHLRC2

Synonyms Polyclonal NHLRC2 antibody, Anti-NHLRC2 antibody, NHLRC 2 antibody, DKFZp779F115 antibody, NHLRC2, NHLRC 2, FLJ33312 antibody, FLJ20147 antibody, FLJ25621 antibody, NHLRC-2, Nhl Repeat Containing 2 antibody, NHLRC-2 antibody, MGC45492 antibody
Specificity NHLRC2 antibody was raised against the N terminal of NHLRC2
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen NHLRC2 antibody was raised using the N terminal of NHLRC2 corresponding to a region with amino acids YSDKDGLLIIGVHSAKFPNEKVLDNIKSAVLRYNITHPMVNDADASLWQE
Assay Information NHLRC2 Blocking Peptide, catalog no. 33R-10237, is also available for use as a blocking control in assays to test for specificity of this NHLRC2 antibody


Western Blot analysis using NHLRC2 antibody (70R-3406)

NHLRC2 antibody (70R-3406) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 79 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of NHLRC2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of NHLRC2 protein is not widely studied, and is yet to be elucidated fully.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using NHLRC2 antibody (70R-3406) | NHLRC2 antibody (70R-3406) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors