NHP2L1 antibody (70R-4715)

Rabbit polyclonal NHP2L1 antibody

Synonyms Polyclonal NHP2L1 antibody, Anti-NHP2L1 antibody, NHP2L1, OTK27 antibody, NHPX antibody, Nhp2 Non-Histone Chromosome Protein 2-Like 1 antibody, SNU13 antibody, NHPL1-2, NHPL1-2 antibody, NHPL1 2 antibody, NHPL1 2
Cross Reactivity Human
Applications WB
Immunogen NHP2L1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MTEADVNPKAYPLADAHLTKKLLDLVQQSCNYKQLRKGANEATKTLNRGI
Assay Information NHP2L1 Blocking Peptide, catalog no. 33R-6538, is also available for use as a blocking control in assays to test for specificity of this NHP2L1 antibody


Western Blot analysis using NHP2L1 antibody (70R-4715)

NHP2L1 antibody (70R-4715) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 14 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of NHP2L1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Originally named because of its sequence similarity to the Saccharomyces cerevisiae NHP2 (non-histone protein 2), this protein appears to be a highly conserved nuclear protein that is a component of the [U4/U6.U5] tri-snRNP. It binds to the 5' stem-loop of U4 snRNA. Two transcript variants encoding the same protein have been found for this gene.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using NHP2L1 antibody (70R-4715) | NHP2L1 antibody (70R-4715) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors