NID2 antibody (70R-6064)

Rabbit polyclonal NID2 antibody

Synonyms Polyclonal NID2 antibody, Anti-NID2 antibody, Osteonidogen antibody, NID2, NID-2 antibody, Nidogen 2 antibody, NID 2, NID-2, NID 2 antibody
Cross Reactivity Human
Applications WB
Immunogen NID2 antibody was raised using a synthetic peptide corresponding to a region with amino acids DDLGHFIPLQCHGKSDFCWCVDKDGREVQGTRSQPGTTPACIPTVAPPMV
Assay Information NID2 Blocking Peptide, catalog no. 33R-1881, is also available for use as a blocking control in assays to test for specificity of this NID2 antibody

Images

Western Blot analysis using NID2 antibody (70R-6064)

NID2 antibody (70R-6064) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 148 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of NID2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Basement membranes, which are composed of type IV collagens, laminins, perlecan, and nidogen, are thin pericellular protein matrices that control a large number of cellular activities, including adhesion, migration, differentiation, gene expression, and apoptosis.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using NID2 antibody (70R-6064) | NID2 antibody (70R-6064) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors