Ninjurin 1 antibody (70R-6116)

Rabbit polyclonal Ninjurin 1 antibody raised against the N terminal of NINJ1

Synonyms Polyclonal Ninjurin 1 antibody, Anti-Ninjurin 1 antibody, Ninjurin -1, Ninjurin 1, NIN1 antibody, Ninjurin 1, Ninjurin 1 antibody, NINJ1 antibody, Ninjurin -1 antibody, NINJURIN antibody
Specificity Ninjurin 1 antibody was raised against the N terminal of NINJ1
Cross Reactivity Human
Applications WB
Immunogen Ninjurin 1 antibody was raised using the N terminal of NINJ1 corresponding to a region with amino acids DSGTEEYELNGGLPPGTPGSPDASPARWGWRHGPINVNHYASKKSAAESM
Assay Information Ninjurin 1 Blocking Peptide, catalog no. 33R-2165, is also available for use as a blocking control in assays to test for specificity of this Ninjurin 1 antibody

Images

Western Blot analysis using Ninjurin 1 antibody (70R-6116)

Ninjurin 1 antibody (70R-6116) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 16 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of NINJ1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance NINJ1 is a homophilic cell adhesion molecule that promotes axonal growth. NINJ1 may play a role in nerve regeneration and in the formation and function of other tissues.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using Ninjurin 1 antibody (70R-6116) | Ninjurin 1 antibody (70R-6116) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors