NIPA2 antibody (70R-6819)

Rabbit polyclonal NIPA2 antibody raised against the middle region of NIPA2

Synonyms Polyclonal NIPA2 antibody, Anti-NIPA2 antibody, NIPA 2, NIPA-2, NIPA 2 antibody, NIPA-2 antibody, NIPA2, Non Imprinted In Prader-Willi/Angelman Syndrome 2 antibody, MGC5466 antibody
Specificity NIPA2 antibody was raised against the middle region of NIPA2
Cross Reactivity Human
Applications WB
Immunogen NIPA2 antibody was raised using the middle region of NIPA2 corresponding to a region with amino acids VYITICSVIGAFSVSCVKGLGIAIKELFAGKPVLRHPLAWILLLSLIVCV
Assay Information NIPA2 Blocking Peptide, catalog no. 33R-9920, is also available for use as a blocking control in assays to test for specificity of this NIPA2 antibody

Images

Western Blot analysis using NIPA2 antibody (70R-6819)

NIPA2 antibody (70R-6819) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 39 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of NIPA2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance NIPA2 belongs to the NIPA family. It is a multi-pass membrane protein. The function of the NIPA2 protein remains unknown.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using NIPA2 antibody (70R-6819) | NIPA2 antibody (70R-6819) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors