NKAIN1 antibody (70R-7160)

Rabbit polyclonal NKAIN1 antibody raised against the middle region of NKAIN1

Synonyms Polyclonal NKAIN1 antibody, Anti-NKAIN1 antibody, NKAIN1, NKAIN 1 antibody, FAM77C antibody, FLJ12650 antibody, NKAIN 1, NKAIN-1 antibody, Na+/K+ Transporting Atpase Interacting 1 antibody, NKAIN-1
Specificity NKAIN1 antibody was raised against the middle region of NKAIN1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen NKAIN1 antibody was raised using the middle region of NKAIN1 corresponding to a region with amino acids TPVLNSRLALEDHHVISVTGCLLDYPYIEALSSALQIFLALFGFVFACYV
Assay Information NKAIN1 Blocking Peptide, catalog no. 33R-9236, is also available for use as a blocking control in assays to test for specificity of this NKAIN1 antibody

Images

Western Blot analysis using NKAIN1 antibody (70R-7160)

NKAIN1 antibody (70R-7160) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 18 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of NKAIN1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance It belongs to the NKAIN family. The exact function of NKAIN1 remains unknown.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using NKAIN1 antibody (70R-7160) | NKAIN1 antibody (70R-7160) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $375.00
Size: 50 ug
OR
Shipping
View Our Distributors