NKAIN4 antibody (70R-7511)

Rabbit polyclonal NKAIN4 antibody raised against the middle region of NKAIN4

Synonyms Polyclonal NKAIN4 antibody, Anti-NKAIN4 antibody, NKAIN 4, NKAIN-4, NKAIN4, NKAIN 4 antibody, Na+/K+ Transporting Atpase Interacting 4 antibody, NKAIN-4 antibody, C20orf58 antibody, bA261N11.2 antibody, FAM77A antibody
Specificity NKAIN4 antibody was raised against the middle region of NKAIN4
Cross Reactivity Human,Mouse
Applications WB
Immunogen NKAIN4 antibody was raised using the middle region of NKAIN4 corresponding to a region with amino acids LLGFVCGCQVVSVFTDEEDSFDFIGGFDPFPLYHVNEKPSSLLSKQVYLP
Assay Information NKAIN4 Blocking Peptide, catalog no. 33R-5141, is also available for use as a blocking control in assays to test for specificity of this NKAIN4 antibody

Images

Western Blot analysis using NKAIN4 antibody (70R-7511)

NKAIN4 antibody (70R-7511) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 23 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of NKAIN4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The specific function of NKAIN4 is not yet known.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using NKAIN4 antibody (70R-7511) | NKAIN4 antibody (70R-7511) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors