NKAIN4 antibody (70R-7530)

Rabbit polyclonal NKAIN4 antibody raised against the N terminal of NKAIN4

Synonyms Polyclonal NKAIN4 antibody, Anti-NKAIN4 antibody, bA261N11.2 antibody, C20orf58 antibody, FAM77A antibody, NKAIN-4, NKAIN-4 antibody, NKAIN 4 antibody, NKAIN 4, NKAIN4, Na+/K+ Transporting Atpase Interacting 4 antibody
Specificity NKAIN4 antibody was raised against the N terminal of NKAIN4
Cross Reactivity Human
Applications WB
Immunogen NKAIN4 antibody was raised using the N terminal of NKAIN4 corresponding to a region with amino acids MGSCSGRCALVVLCAFQLVAALERQVFDFLGYQWAPILANFVHIIIVILG
Assay Information NKAIN4 Blocking Peptide, catalog no. 33R-6073, is also available for use as a blocking control in assays to test for specificity of this NKAIN4 antibody

Images

Western Blot analysis using NKAIN4 antibody (70R-7530)

NKAIN4 antibody (70R-7530) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 23 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of NKAIN4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The specific function of NKAIN4 is not yet known.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using NKAIN4 antibody (70R-7530) | NKAIN4 antibody (70R-7530) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors